Iright
BRAND / VENDOR: Proteintech

Proteintech, 12927-1-AP, TXNL4B Polyclonal antibody

CATALOG NUMBER: 12927-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TXNL4B (12927-1-AP) by Proteintech is a Polyclonal antibody targeting TXNL4B in WB, ELISA applications with reactivity to human, mouse, rat samples 12927-1-AP targets TXNL4B in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information TXNL4B(Thioredoxin-like protein 4B) is also named as DIM2, DLP and belongs to the DIM1 family. It is implicated in not only cell cycle progression but also in a more specific molecular process such as pre-mRNA splicing. It is required for S/G(2) transition. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3620 Product name: Recombinant human TXNL4B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-149 aa of BC009646 Sequence: MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI Predict reactive species Full Name: thioredoxin-like 4B Calculated Molecular Weight: 149 aa, 17 kDa Observed Molecular Weight: 17 kDa GenBank Accession Number: BC009646 Gene Symbol: TXNL4B Gene ID (NCBI): 54957 RRID: AB_2877893 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NX01 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924