Proteintech, 12928-1-AP, IRF6 Polyclonal antibody

Size: 20ul / 150ul The IRF6 (12928-1-AP) by Proteintech is a Polyclonal antibody targeting IRF6 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 12928-1-AP targets IRF6 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, A549 cells, HaCaT cells Positive IHC detected in: human lung tissue, mouse kidney tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HaCaT cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information The interferon regulatory factor (IRF) family of genes directs the expression and activity of interferon and thus can strictly regulate innate immunity. Interferon regulatory factor 6 (IRF6) belongs to a family of nine transcription factors that share a highly conserved helix−turn−helix DNA-binding domain and a less conserved protein-binding domain. IRF6 regulates the balance between immature ectoderm differentiation and proliferation during craniofacial morphogenesis. IRF6 functions as a tumor suppressor gene in breast cancer, cervical cancer, nasopharyngeal carcinoma and so on. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3623 Product name: Recombinant human IRF6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 166-467 aa of BC014852 Sequence: LNINGSPMAPASVGNCSVGNCSPEAVWPKTEPLEMEVPQAPIQPFYSSPELWISSLPMTDLDIKFQYRGKEYGQTMTVSNPQGCRLFYGDLGPMPDQEELFGPVSLEQVKFPGPEHITNEKQKLFTSKLLDVMDRGLILEVSGHAIYAIRLCQCKVYWSGPCAPSLVAPNLIERQKKVKLFCLETFLSDLIAHQKGQIEKQPPFEIYLCFGEEWPDGKPLERKLILVQVIPVVARMIYEMFSGDFTRSFDSGSVRLQISTPDIKDNIVAQLKQLYRILQTQESWQPMQPTPSMQLPPALPPQ Predict reactive species Full Name: interferon regulatory factor 6 Calculated Molecular Weight: 467 aa, 53 kDa Observed Molecular Weight: 53-60 kDa GenBank Accession Number: BC014852 Gene Symbol: IRF6 Gene ID (NCBI): 3664 RRID: AB_3085402 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14896 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.