Proteintech, 12944-1-AP, GCAP1 Polyclonal antibody

Size: 20ul / 150ul The GCAP1 (12944-1-AP) by Proteintech is a Polyclonal antibody targeting GCAP1 in WB, ELISA applications with reactivity to human, mouse, rat samples 12944-1-AP targets GCAP1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Y79 cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4017 Product name: Recombinant human GUCA1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-201 aa of BC031663 Sequence: MGNVMEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIQAIRAINPCSDTTMTAEEFTDTVFSKIDVNGDGELSLEEFIEGVQKDQMLLDTLTRSLDLTRIVRRLQNGEQDEEGADEAAEAAG Predict reactive species Full Name: guanylate cyclase activator 1A (retina) Calculated Molecular Weight: 23 kDa Observed Molecular Weight: 23-24 kDa GenBank Accession Number: BC031663 Gene Symbol: GUCA1A Gene ID (NCBI): 2978 RRID: AB_10638474 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P43080 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.