Proteintech, 12955-1-AP, ILK Polyclonal antibody

Size: 20ul / 150ul The ILK (12955-1-AP) by Proteintech is a Polyclonal antibody targeting ILK in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 12955-1-AP targets ILK in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse kidney tissue Positive IP detected in: mouse kidney tissue Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Integrin-linked kinase (ILK) is an ankyrin-repeat containing serine-threonine protein kinase capable of interacting with the cytoplasmic domains of integrin β1, β2, and β3 subunits and whose kinase activity is modulated by cell-extracellular matrix interactions (PMID: 9539744). This protein belongs to the protein kinase superfamily. It can be autophosphorylated on serine residues. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3570 Product name: Recombinant human ILK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 102-451 aa of BC001554 Sequence: VPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQD Predict reactive species Full Name: integrin-linked kinase Calculated Molecular Weight: 451 aa, 59 kDa Observed Molecular Weight: 51-59 kDa GenBank Accession Number: BC001554 Gene Symbol: ILK Gene ID (NCBI): 3611 RRID: AB_2127053 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13418 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.