Iright
BRAND / VENDOR: Proteintech

Proteintech, 12963-1-AP, CHAD Polyclonal antibody

CATALOG NUMBER: 12963-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CHAD (12963-1-AP) by Proteintech is a Polyclonal antibody targeting CHAD in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 12963-1-AP targets CHAD in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, Jurkat cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Chondroadherin (CHAD), also known as cartilage leucine-rich protein, is a prominent noncollagenous extracellular protein in cartilage. It was first isolated from bovine cartilage. The primary structure of CHAD shows that it belongs to the family of leucine-rich repeat (LRR) proteins. It is expressed at high levels in certain zones of cartilage and also has been detected in bone, tendon, bone marrow, and chondrosarcoma cells. CHAD promotes attachment of chondrocytes, fibroblasts, and osteoblasts, mediated via the integrin alpha2beta1. It has also been shown to bind to collagen type II and both collagen type II and chondroadherin interact with integrin alpha2beta1. Besides, CHAD may play an important role in the regulation of chondrocyte growth and proliferation. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4077 Product name: Recombinant human CHAD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-359 aa of BC036360 Sequence: QNCHCHSDLQHVICDKVGLQKIPKVSEKTKLLNLQRNNFPVLAANSFRAMPNLVSLHLQHCQIREVAAGAFRGLKQLIYLYLSHNDIRVLRAGAFDDLTELTYLYLDHNKVTELPRGLLSPLVNLFILQLNNNKIRELRAGAFQGAKDLRWLYLSENALSSLQPGALDDVENLAKFHVDRNQLSSYPSAALSKLRVVEELKLSHNPLKSIPDNAFQSFGRYLETLWLDNTNLEKFSDGAFLGVTTLKHVHLENNRLNQLPSNFPFDSLETLALTNNPWKCTCQLRGLRRWLEAKASRPDATCASPAKFKGQHIRDTDAFRSCKFPTKRSKKAGRH Predict reactive species Full Name: chondroadherin Calculated Molecular Weight: 359 aa, 40.5 kDa Observed Molecular Weight: 41 kDa GenBank Accession Number: BC036360 Gene Symbol: CHAD Gene ID (NCBI): 1101 RRID: AB_2244851 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15335 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924