Proteintech, 12972-1-AP, JAM2 Polyclonal antibody

Size: 20ul / 150ul The JAM2 (12972-1-AP) by Proteintech is a Polyclonal antibody targeting JAM2 in WB, ELISA applications with reactivity to human, mouse, rat samples 12972-1-AP targets JAM2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human placenta tissue, human heart tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3431 Product name: Recombinant human JAM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-298 aa of BC017779 Sequence: MARRSRHRLLLLLLRYLVVALGYHKAYGFSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNISGIIAAVVVVALVISVCGLGVCYAQRKGYFSKETSFQKSNSSSKATTMSENDFKHTKSFII Predict reactive species Full Name: junctional adhesion molecule 2 Calculated Molecular Weight: 298 aa, 33 kDa Observed Molecular Weight: 33 kDa, 43 kDa GenBank Accession Number: BC017779 Gene Symbol: JAM2 Gene ID (NCBI): 58494 RRID: AB_10638910 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P57087 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.