Proteintech, 12988-1-AP, ARMER Polyclonal antibody

Size: 20ul / 150ul The ARMER (12988-1-AP) by Proteintech is a Polyclonal antibody targeting ARMER in WB, ELISA applications with reactivity to human, mouse, rat samples 12988-1-AP targets ARMER in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, mouse lung tissue, K-562 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3639 Product name: Recombinant human ARL6IP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-203 aa of BC010281 Sequence: MAEGDNRSTNLLAAETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLVFLIIYYLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEEKPKMYFMTMIVSLAAVAWVGQQVHNLLLTYLIVTSLLLLPGLNQHGIILKYIGMAKREINKLLKQKEKKNE Predict reactive species Full Name: ADP-ribosylation factor-like 6 interacting protein 1 Calculated Molecular Weight: 203 aa, 23 kDa Observed Molecular Weight: 22-24 kDa GenBank Accession Number: BC010281 Gene Symbol: ARMER Gene ID (NCBI): 23204 RRID: AB_10639515 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15041 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.