Iright
BRAND / VENDOR: Proteintech

Proteintech, 12997-1-AP, CEBPG Polyclonal antibody

CATALOG NUMBER: 12997-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CEBPG (12997-1-AP) by Proteintech is a Polyclonal antibody targeting CEBPG in IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 12997-1-AP targets CEBPG in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: mouse liver tissue, mouse colon tissue, rat liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:1000-1:4000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3663 Product name: Recombinant human CEBPG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-150 aa of BC013128 Sequence: MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDNAGQ Predict reactive species Full Name: CCAAT/enhancer binding protein (C/EBP), gamma Calculated Molecular Weight: 150 aa, 16 kDa Observed Molecular Weight: 16-18 kDa GenBank Accession Number: BC013128 Gene Symbol: CEBPG Gene ID (NCBI): 1054 RRID: AB_2877902 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P53567 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924