Proteintech, 12999-1-AP, Ephrin B1 Polyclonal antibody

Size: 20ul / 150ul The Ephrin B1 (12999-1-AP) by Proteintech is a Polyclonal antibody targeting Ephrin B1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 12999-1-AP targets Ephrin B1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, rat kidney tissue Positive IHC detected in: human kidney tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information EFNB1 (Ephrin B1) is a member of the ephrin family, which are membrane-bound guidance cues that interact with Eph receptors, a family of receptor tyrosine kinases. EFNB1 is X-inactivated, and it has been proposed that in heterozygous females, patchy loss of ephrin B1 disturbs tissue boundary formation at the developing coronal suture (PMID: 34824583, 18627045). EFNB1 mainly plays a central part in cell adhesion, angiogenesis, and development of the nervous system (PMID: 30326247). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3669 Product name: Recombinant human EFNB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 32-239 aa of BC016649 Sequence: LEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDGFFNSKVA Predict reactive species Full Name: ephrin-B1 Calculated Molecular Weight: 346 aa, 38 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC016649 Gene Symbol: Ephrin B1 Gene ID (NCBI): 1947 RRID: AB_10644156 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P98172 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.