Iright
BRAND / VENDOR: Proteintech

Proteintech, 13006-1-AP, CMAS Polyclonal antibody

CATALOG NUMBER: 13006-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CMAS (13006-1-AP) by Proteintech is a Polyclonal antibody targeting CMAS in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 13006-1-AP targets CMAS in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat pancreas tissue, mouse brain tissue Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Cytidine monophosphate N-acetylneuraminic acid synthetase (CMAS), a key enzyme in the incorporation pathway, catalyzes the synthesis of CMP-sialic acid by utilizing CTP and sialic acid. Neu5Ac is activated in the nucleus by CMAS to form CMP-Neu5Ac, which is transported to the Golgi apparatus by SLC35A1 for sialylation of glycoproteins and gangliosides catalyzed by specific sialy ltransferases (PMID: 30568043). Low CMAS gene expression correlated with reduced recurrence-free survival in a human colorectal cancer cohort (PMID: 30578646). Western blots indicated a range of bands at ~ 48 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3686 Product name: Recombinant human CMAS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-263 aa of BC016609 Sequence: MDSVEKGAATSVSNPRGRPSRGRPPKLQRNSRGGQGRGVEKPPHLAALILARGGSKGIPLKNIKHLAGVPLIGWVLRAALDSGAFQSVWVSTDHDEIENVAKQFGAQVHRRSSEVSKDSSTSLDAIIEFLNYHNEVDIVGNIQATSPCLHPTDLQKVAEMIREEGYDSVFSVVRRHQFRWSEIQKGVREVTEPLNLNPAKRPRRQDWDGELYENGSFYFAKRHLIEMGYLQGGKMAYYEMRAEHSVDIDVDIDWPIAEQRVLR Predict reactive species Full Name: cytidine monophosphate N-acetylneuraminic acid synthetase Calculated Molecular Weight: 48 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: BC016609 Gene Symbol: CMAS Gene ID (NCBI): 55907 RRID: AB_3085404 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NFW8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924