Iright
BRAND / VENDOR: Proteintech

Proteintech, 13021-1-AP, ENTPD3 Polyclonal antibody

CATALOG NUMBER: 13021-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ENTPD3 (13021-1-AP) by Proteintech is a Polyclonal antibody targeting ENTPD3 in WB, IF/ICC, ELISA applications with reactivity to human samples 13021-1-AP targets ENTPD3 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human brain tissue, Jurkat cells, Raji cells Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information ENTPD3, also known as NTPDase3 or CD39L3, belongs to the GDA1/CD39 NTPase family. ENTPD3 has a threefold preference for the hydrolysis of ATP over ADP. ENTPD3 is expressed in adult brain, pancreas, spleen and prostate, but not in liver and peripheral blood leukocytes. ENTPD3 has 2 isoforms with the molecular mass of 51 and 59 kDa. Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4114 Product name: Recombinant human ENTPD3 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 45-366 aa of BC029869 Sequence: IHKQEVLPPGLKYGIVLDAGSSRTTVYVYQWPAEKENNTGVVSQTFKCSVKGSGISSYGNNPQDVPRAFEECMQKVKGQVPSHLHGSTPIHLGATAGMRLLRLQNETAANEVLESIQSYFKSQPFDFRGAQIISGQEEGVYGWITANYLMGNFLEKNLWHMWVHPHGVETTGALDLGGASTQISFVAGEKMDLNTSDIMQVSLYGYVYTLYTHSFQCYGRNEAEKKFLAMLLQNSPTKNHLTNPCYPRDYSISFTMGHVFDSLCTVDQRPESYNPNDVITFEGTGDPSLCKEKVASIFDFKACHDQETCSFDGVYQPKIKGP Predict reactive species Full Name: ectonucleoside triphosphate diphosphohydrolase 3 Calculated Molecular Weight: 529 aa, 59 kDa Observed Molecular Weight: 59 kDa GenBank Accession Number: BC029869 Gene Symbol: ENTPD3 Gene ID (NCBI): 956 RRID: AB_2100082 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75355 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924