Proteintech, 13033-1-AP, SACM1L Polyclonal antibody

Size: 20ul / 150ul The SACM1L (13033-1-AP) by Proteintech is a Polyclonal antibody targeting SACM1L in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 13033-1-AP targets SACM1L in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human kidney tissue, A549 cells, mouse kidney tissue, mouse lung tissue, human brain tissue Positive IP detected in: mouse kidney tissue Positive IHC detected in: human brain tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information SACM1L(Suppressor of actin mutations 1-like protein) is also named KIAA0851. It is a phosphoinositide phosphatase that hydrolyzes PtdIns3P and PtdIns4P and has low activity towards PtdIns(3,5)P2. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3682 Product name: Recombinant human SACM1L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 154-500 aa of BC016559 Sequence: QEMSLLERADQRFVWNGHLLRELSAQPEVHRFALPVLHGFITMHSCSINGKYFDWILISRRSCFRAGVRYYVRGIDSEGHAANFVETEQIVHYNGSKASFVQTRGSIPVFWSQRPNLKYKPLPQISKVANHMDGFQRHFDSQVIIYGKQVIINLINQKGSEKPLEQTFATMVSSLGSGMMRYIAFDFHKECKNMRWDRLSILLDQVAEMQDELSYFLVDSAGQVVANQEGVFRSNCMDCLDRTNVIQSLLARRSLQAQLQRLGVLHVGQKLEEQDEFEKIFKNAWADNANACAKQYAGTGALKTDFTRTGKRTHLGLIMDGWNSMIRYYKNNFSDGFRQDSIDLFLG Predict reactive species Full Name: SAC1 suppressor of actin mutations 1-like (yeast) Calculated Molecular Weight: 587 aa, 67 kDa Observed Molecular Weight: 60-67 kDa GenBank Accession Number: BC016559 Gene Symbol: SACM1L Gene ID (NCBI): 22908 RRID: AB_2301284 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NTJ5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.