Proteintech, 13054-1-AP, THRSP Polyclonal antibody

Size: 20ul / 150ul The THRSP (13054-1-AP) by Proteintech is a Polyclonal antibody targeting THRSP in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 13054-1-AP targets THRSP in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue Positive IP detected in: mouse liver tissue Positive IHC detected in: human liver tissue, human liver cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:100-1:600 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information THRSP (Thyroid hormone-inducible hepatic protein)  is a protein that in humans is encoded by the THRSP gene. The protein encoded by this gene is similar to the gene product of S14, a rat gene whose expression is limited to liver and adipose tissue and is controlled by nutritional and hormonal factors. This gene has been shown to be expressed in liver and adipocytes, particularly in lipomatous modules. It is also found to be expressed in lipogenic breast cancers, which suggests a role in controlling tumor lipid metabolism (RefSeq). This antibody works well in IHC, WB and IF. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3721 Product name: Recombinant human THRSP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-146 aa of BC031989 Sequence: MQVLTKRYPKNCLLTVMDRYAAEVHNMEQVVMIPSLLRDVQLSGPGGQAQAEAPDLYTYFTMLKAICVDVDHGLLPREEWQAKVAGSEENGTAETEEVEDESASGELDLEAQFHLHFSSLHHILMHLTEKAQEVTRKYQEMTGQVW Predict reactive species Full Name: thyroid hormone responsive (SPOT14 homolog, rat) Calculated Molecular Weight: 146 aa, 17 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC031989 Gene Symbol: THRSP Gene ID (NCBI): 7069 RRID: AB_2877906 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92748 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.