Iright
BRAND / VENDOR: Proteintech

Proteintech, 13056-1-AP, LXN Polyclonal antibody

CATALOG NUMBER: 13056-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LXN (13056-1-AP) by Proteintech is a Polyclonal antibody targeting LXN in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 13056-1-AP targets LXN in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse lung tissue, rat lung tissue Positive IP detected in: mouse lung tissue Positive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Latexin, also named as LTXN, LXN, ECI, MUM and TCI, is hardly reversible, non-competitive, and potent inhibitor of CPA1, CPA2 and CPA4. It may function as a neuroprotective mechanism against tau toxicity. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3726 Product name: Recombinant human LXN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-222 aa of BC005346 Sequence: MEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYRLKFAVEEIIQKQVKVNCTAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTFYQRLKSMKEPLEAQNIPDNFGNVSPEMTLVLHLAWVACGYIIWQNSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEVQLE Predict reactive species Full Name: latexin Calculated Molecular Weight: 222 aa, 26 kDa Observed Molecular Weight: 26 kDa GenBank Accession Number: BC005346 Gene Symbol: LXN Gene ID (NCBI): 56925 RRID: AB_2139511 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BS40 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924