Proteintech, 13062-1-AP, SNX22 Polyclonal antibody

Size: 20ul / 150ul The SNX22 (13062-1-AP) by Proteintech is a Polyclonal antibody targeting SNX22 in IP, ELISA applications with reactivity to human, mouse samples 13062-1-AP targets SNX22 in IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IP detected in: mouse liver tissue Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Sorting nexins (SNXs) are a large group of proteins that contain Phox (PX) domain and involve in regulating endocytosis and endosome sorting. SNX22 (sorting nexin 22) is a 193 amino acid protein that contains one phox domain and belongs to the SNX family. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3751 Product name: Recombinant human SNX22 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-120 aa of BC019655 Sequence: MLEVHIPSVGPEAEGPRQSPEKSHMVFRVEVLCSGRRHTVPRRYSEFHALHKRIKKLYKVPDFPSKRLPNWRTRGLEQRRQGLEAYIQGILYLNQEVPKELLEFLRLRHFPTDPKASNWG Predict reactive species Full Name: sorting nexin 22 Calculated Molecular Weight: 193 aa, 22 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC019655 Gene Symbol: SNX22 Gene ID (NCBI): 79856 RRID: AB_2877909 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96L94 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.