Iright
BRAND / VENDOR: Proteintech

Proteintech, 13095-1-AP, TRP2/DCT Polyclonal antibody

CATALOG NUMBER: 13095-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TRP2/DCT (13095-1-AP) by Proteintech is a Polyclonal antibody targeting TRP2/DCT in IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat, monkey samples 13095-1-AP targets TRP2/DCT in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, monkey samples. Tested Applications Positive IP detected in: HL-60 cells Positive IHC detected in: human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information DCT(L-dopachrome Delta-isomerase) is also named as TYRP2,TRP2 and belongs to the tyrosinase family.human TYRP2 protein has 83% identity and 90% similarity to the mouse sequence and has all the structural characteristics of the tyrosinase protein family, including a signal peptide, 15 conserved cysteine residues, 2 copper-binding domains, and a C-terminal membrane-spanning region(PMID:8206391). Specification Tested Reactivity: human, mouse, rat, monkey Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3714 Product name: Recombinant human DCT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC028311 Sequence: MSPLWWGFLLSCLGCKILPGAQGQFPRVCMTVDSLVNKECCPRLGAESANVCGSQQGRGQCTEVRADTRPWSGPYILRNQDDRELWPRKFFHRTCKCTGNFAGYNCGDCKFGWTGPNCERKKPPVIRQNIHSLSPQEREQFLGALDLAKKRVHPDYVITTQHWLGLLGPNGTQPQFANCSVYDFFVWLHYYSVRDTLLGPGRPYRAIDFSHQGPAFVTWHRYHLLCLERDLQRLIGNESFALPYWNFATGRNECDVCTDQLFGAARPDDPTLISRNSRFSSWETVCDSLDDYNHLVTLCNGTYEGLLRRNQMGRNSMKLPTLKDIRDCLSLQKFDNPPFFQNSTFSFRNA Predict reactive species Full Name: dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) Calculated Molecular Weight: 519 aa, 59 kDa Observed Molecular Weight: 59 kDa GenBank Accession Number: BC028311 Gene Symbol: DCT Gene ID (NCBI): 1638 RRID: AB_2090576 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P40126 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924