Proteintech, 13109-1-AP, UBXN11 Polyclonal antibody

Size: 20ul / 150ul The UBXN11 (13109-1-AP) by Proteintech is a Polyclonal antibody targeting UBXN11 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 13109-1-AP targets UBXN11 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: PC-3 cells, mouse testis tissue Positive IP detected in: mouse testis tissue Positive IHC detected in: human testis tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3772 Product name: Recombinant human UBXN11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-324 aa of BC038106 Sequence: MSSPLASLSKTRKVPLPSEPMNPGRRGIRIYGDEDEVDMLSDGCGSEEKISVPSCYGGIGAPVSRQVPASHDSELMAFMTRKLWDLEQQVKAQTDEILSKDQKIAALEDLVQTLRPHPAEATLQRQEELETMCVQLQRQVREMERFLSDYGLQWVGEPMDQEDSESKTVSEHGERDWMTAKKFWKPGDSLAPPEVDFDRLLASLQDLSELVVEGDTQVTPVPGGARLRTLEPIPLKLYRNGIMMFDGPFQPFYDPSTQRCLRDILDGFFPSELQRLYPNGVPFKVISCSSNHTFGDFEGSGDTQPPQTPPILRGSRCTPWGTPV Predict reactive species Full Name: UBX domain protein 11 Calculated Molecular Weight: 57 kDa Observed Molecular Weight: 48-54 kDa GenBank Accession Number: BC038106 Gene Symbol: UBXN11 Gene ID (NCBI): 91544 RRID: AB_2288037 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5T124 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.