Proteintech, 13115-1-AP, VAMP1 Polyclonal antibody

Size: 20ul / 150ul The VAMP1 (13115-1-AP) by Proteintech is a Polyclonal antibody targeting VAMP1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 13115-1-AP targets VAMP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information VAMP1, also named as synaptobrevin 1, is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. VAMP1 is a part of the SNARE (soluble NSF-attachment protein receptor) complex. Characterized by a common sequence called the SNARE motif, SNARE proteins are involved in membrane fusion and vesicular transport (PMID: 11252968). VAMP1 is involved in synaptic vesicle exocytosis, a fundamental step in neurotransmitter release. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3787 Product name: Recombinant human VAMP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC023286 Sequence: MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCKMMIM Predict reactive species Full Name: vesicle-associated membrane protein 1 (synaptobrevin 1) Calculated Molecular Weight: 117 aa, 13 kDa Observed Molecular Weight: 13 kDa GenBank Accession Number: BC023286 Gene Symbol: VAMP1 Gene ID (NCBI): 6843 RRID: AB_2214772 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P23763 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.