Iright
BRAND / VENDOR: Proteintech

Proteintech, 13117-2-AP, PKD2L1 Polyclonal antibody

CATALOG NUMBER: 13117-2-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PKD2L1 (13117-2-AP) by Proteintech is a Polyclonal antibody targeting PKD2L1 in WB, ELISA applications with reactivity to human, mouse, rat samples 13117-2-AP targets PKD2L1 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3807 Product name: Recombinant human PKD2L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 561-805 aa of BC025665 Sequence: NDTYSEVKEELAGQKDELQLSDLLKQGYNKTLLRLRLRKERVSDVQKVLQGGEQEIQFEDFTNTLRELGHAEHEITELTATFTKFDRDGNRILDEKEQEKMRQDLEEERVALNTEIEKLGRSIVSSPQGKSGPEAARAGGWVSGEEFYMLTRRVLQLETVLEGVVSQIDAVGSKLKMLERKGWLAPSPGVKEQAIWKHPQPAPAVTPDPWGVQGGQESEVPYKREEEALEERRLSRGEIPTLQRS Predict reactive species Full Name: polycystic kidney disease 2-like 1 Calculated Molecular Weight: 805 aa, 92 kDa Observed Molecular Weight: 75-85 kDa, 92 kDa GenBank Accession Number: BC025665 Gene Symbol: PKD2L1 Gene ID (NCBI): 9033 RRID: AB_2163481 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9P0L9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924