Iright
BRAND / VENDOR: Proteintech

Proteintech, 13143-1-AP, PLS1 Polyclonal antibody

CATALOG NUMBER: 13143-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PLS1 (13143-1-AP) by Proteintech is a Polyclonal antibody targeting PLS1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 13143-1-AP targets PLS1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, mouse colon tissue, mouse kidney tissue Positive IHC detected in: human kidney tissue, Human Colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information PLS1 also known as Fimbrin, Plastin 1, is an actin-binding protein in the absence of calcium. In the inner ear, PLS1 is required for stereocilia formation. PLS1 Mediates liquid packing of actin filaments that is necessary for stereocilia to grow to their proper dimensions. PLS1 is specifically expressed at high levels in the small intestine, colon, and kidney; relatively expressed at lower levels in the lung and stomach(PMID: 8139549). PLS1 is required for normal hearing in humans and mice. Mutations in PLS1, encoding fimbrin, cause autosomal dominant nonsyndromic hearing loss(NSHL)(PMID: 31397523). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3532 Product name: Recombinant human PLS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 331-629 aa of BC031083 Sequence: DLKRAGLMLQEADKLGCKQFVTPADVVSGNPKLNLAFVANLFNTYPCLHKPNNNDIDMNLLEGESKEERTFRNWMNSLGVNPYINHLYSDLADALVIFQLYEMIRVPVNWRHVNKPPYPALGGNMKKIENCNYAVELGKNKAKFSLVGIAGQDLNEGNSTLTLALVWQLMRRYTLNVLSDLGEGEKVNDEIIIKWVNQTLKSANKKTSISSFKDKSISTSLPVLDLIDAIAPNAVRQEMIRRENLSDEDKLNNAKYAISVARKIGARIYALPDDLVEVKPKMVMTVFACLMGKGLNRIK Predict reactive species Full Name: plastin 1 (I isoform) Calculated Molecular Weight: 629 aa, 70 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC031083 Gene Symbol: PLS1 Gene ID (NCBI): 5357 RRID: AB_2935432 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14651 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924