Iright
BRAND / VENDOR: Proteintech

Proteintech, 13148-1-AP, ZC3HC1 Polyclonal antibody

CATALOG NUMBER: 13148-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZC3HC1 (13148-1-AP) by Proteintech is a Polyclonal antibody targeting ZC3HC1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 13148-1-AP targets ZC3HC1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, mouse skeletal muscle tissue, mouse heart tissue, mouse lung tissue Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:200-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3744 Product name: Recombinant human ZC3HC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-212 aa of BC028917 Sequence: MTDLDASFGLTSSPIPGLEGRPERLPLVPESPRRMMTRSQDATFSPGSEQAEKSPGPIVSRTRSWDSSSPVDRPEPEAASPTTRTRPVTRSMGTGDTPGLEVPSSPLRKAKRARLCSSSSSDTSSRSFFDPTSQHRDWCPWVNITLGKESRENGGTEPDASAPAEPGWKAVLTILLAHKQSSQPAETDSMSLSEKSRKVFRIFRQWESLCSC Predict reactive species Full Name: zinc finger, C3HC-type containing 1 Calculated Molecular Weight: 502 aa, 55 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC028917 Gene Symbol: ZC3HC1 Gene ID (NCBI): 51530 RRID: AB_2217514 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86WB0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924