Iright
BRAND / VENDOR: Proteintech

Proteintech, 13154-1-AP, ST3GAL6 Polyclonal antibody

CATALOG NUMBER: 13154-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ST3GAL6 (13154-1-AP) by Proteintech is a Polyclonal antibody targeting ST3GAL6 in WB, IHC, ELISA applications with reactivity to human, mouse samples 13154-1-AP targets ST3GAL6 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: MCF-7 cells, human heart tissue, Sp2/0 cells, human placenta tissue Positive IHC detected in: human liver tissue, human urothelial carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ST3GAL6, also named as SIAT10, belongs to the glycosyltransferase 29 family. ST3GAL6 is involved in the synthesis of sialyl-paragloboside, which is a precursor of sialyl-Lewis X determinant. ST3GAL6 has a alpha-2,3-sialyltransferase activity toward Gal-beta1,4-GlcNAc structure on glycoproteins and glycolipids. ST3GAL6 is known to promote cell adhesion and migration of multiple myeloma cells by increasing the synthesis of selectin ligands. ST3GAL6 has 2 isoforms with the molecular mass of 25 and 38 kDa. Sometimes higher molecular weight about 50-60 kDa can also be observed, which may be a glycosylated modified variant of ST3GAL6. (PMID: 31914669, 30220088) Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3782 Product name: Recombinant human ST3GAL6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-331 aa of BC023312 Sequence: GTNVYWVAPVEMKRRNKIQPCLSKPAFASLLRFHQFHPFLCAADFRKIASLYGSDKFDLPYGMRTSAEYFRLALSKLQSCDLFDEFDNIPCKKCVVVGNGGVLKNKTLGEKIDSYDVIIRMNNGPVLGHEEEVGRRTTFRLFYPESVFSDPIHNDPNTTVILTAFKPHDLRWLLELLMGDKINTNGFWKKPALNLIYKPYQIRILDPFIIRTAAYELLHFPKVFPKNQKPKHPTTGIIAITLAFYICHEVHLAGFKYNFSDLKSPLHYYGNATMSLMNKNAYHNVTAEQLFLKDIIEKNLVINLTQD Predict reactive species Full Name: ST3 beta-galactoside alpha-2,3-sialyltransferase 6 Calculated Molecular Weight: 331 aa, 38 kDa Observed Molecular Weight: 50-60 kDa GenBank Accession Number: BC023312 Gene Symbol: ST3GAL6 Gene ID (NCBI): 10402 RRID: AB_10646441 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y274 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924