Proteintech, 13157-1-AP, DNAJB9 Polyclonal antibody

Size: 20ul / 150ul The DNAJB9 (13157-1-AP) by Proteintech is a Polyclonal antibody targeting DNAJB9 in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples 13157-1-AP targets DNAJB9 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse kidney tissue, mouse testis tissue Positive IP detected in: mouse testis tissue Positive IHC detected in: human breast cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3789 Product name: Recombinant human DNAJB9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 26-223 aa of BC028912 Sequence: SYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDAEAKFREIAEAYETLSDANRRKEYDTLGHSAFTSGKGQRGSGSSFEQSFNFNFDDLFKDFGFFGQNQNTGSKKRFENHFQTRQDGGSSRQRHHFQEFSFGGGLFDDMFEDMEKMFSFSGFDSTNQHTVQTENRFHGSSKHCRTVTQRRGNMVTTYTDCSGQ Predict reactive species Full Name: DnaJ (Hsp40) homolog, subfamily B, member 9 Calculated Molecular Weight: 223 aa, 26 kDa Observed Molecular Weight: 26-30 kDa GenBank Accession Number: BC028912 Gene Symbol: DNAJB9 Gene ID (NCBI): 4189 RRID: AB_2877918 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UBS3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.