Iright
BRAND / VENDOR: Proteintech

Proteintech, 13159-1-AP, DHX36 Polyclonal antibody

CATALOG NUMBER: 13159-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DHX36 (13159-1-AP) by Proteintech is a Polyclonal antibody targeting DHX36 in WB, IHC, IP, ELISA applications with reactivity to human samples 13159-1-AP targets DHX36 in WB, IHC, IF, IP, CoIP, RIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, human brain tissue, PC-3 cells, HEK-293T cells, A431 cells Positive IP detected in: PC-3 cells, A431 cells Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information DHX36, also known as RNA associated with AU-rich element (RHAU) and G4R1, is an adenosine triphosphate (ATP)-dependent RNA helicase that belongs to the DExH/D family of RNA modifying enzymes. Proteins in this family involve in a wide range of cellular functions including RNA splicing, ribosome assembly, messenger RNA (mRNA) stability, microRNA processing, ribonucleoprotein remodeling and RNA trafficking. DHX36 is an RNA helicase that has specificity for DNA and RNA G4-quadruplexes, and resolves G4 structures into separate nucleotide strands for metabolic processing of G-rich sequence. Specification Tested Reactivity: human Cited Reactivity: human, mouse, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3799 Product name: Recombinant human DHX36 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-385 aa of BC036035 Sequence: MSYDYHQNWGRDGGPRSSGGGYGGGPAGGHGGNRGSGGGGGGGGGGRGGRGRHPGHLKGREIGMWYAKKQGQKNKEAERQERAVVHMDERREEQIVQLLNSVQAKNDKESEAQISWFAPEDHGYGTEVSTKNTPCSENKLDIQEKKLINQEKKMFRIRNRSYIDRDSEYLLQENEPDGTLDQKLLEDLQKKKNDLRYIEMQHFREKLPSYGMQKELVNLIDNHQVTVISGETGCGKTTQVTQFILDNYIERGKGSACRIVCTQPRRISAISVAERVAAERAESCGSGNSTGYQIRLQSRLPRKQGSILYCTTGIILQWLQSDPYLSSVSHIVLDEIHERNLQSDVLMTVVKDLLNFRSDLKVILMSATLNAEKFSEYFGNCPMIH Predict reactive species Full Name: DEAH (Asp-Glu-Ala-His) box polypeptide 36 Calculated Molecular Weight: 1008 aa, 115 kDa Observed Molecular Weight: 110-120 kDa GenBank Accession Number: BC036035 Gene Symbol: DHX36 Gene ID (NCBI): 170506 RRID: AB_2092157 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H2U1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924