Iright
BRAND / VENDOR: Proteintech

Proteintech, 13168-1-AP, DCBLD2 Polyclonal antibody

CATALOG NUMBER: 13168-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DCBLD2 (13168-1-AP) by Proteintech is a Polyclonal antibody targeting DCBLD2 in WB, IHC, IP, ELISA applications with reactivity to human samples 13168-1-AP targets DCBLD2 in WB, IHC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MKN-45 cells, human liver tissue, human brain tissue, SW 1990 cells, U2OS cells Positive IP detected in: U2OS cells Positive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information DCBLD2, also known as ESDN or CLCP1, was first identified from human coronary arterial cells by a signal sequence trap method. DCBLD2 regulates proliferation, migration, and invasion in various tumors, including glioma, hypopharyngeal squamous cell carcinoma, and myxofibrosarcoma. The human DCBLD2 protein has a predicted molecular mass of ∼80 kDa based on its amino acid sequence, although it regularly displays an effective molecular mass of ∼130 kDa via SDS-PAGE (PMID: 30902898). Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3821 Product name: Recombinant human DCBLD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 519-743 aa of BC029658 Sequence: YDLPYWDRAGFYLMVSLACRHNEGWWKGMKQFLPAKAVDHEETPVRYSSSEVNHLSPREVTTVLQADSAEYAQPLVGGIVGTLHQRSTFKPEEGKEAGYADLDPYNSPGQEVYHAYAEPLPITGPEYATPIIMDMSGHPTTSVGQPSTSTFKATGNQPPPLVGTYNTLLSRTDSCSSAQAQYDTPKAGKPGLPAPDELVYQVPQSTQEVSGAGRDGECDVFKEIL Predict reactive species Full Name: discoidin, CUB and LCCL domain containing 2 Calculated Molecular Weight: 775 aa, 89 kDa Observed Molecular Weight: 93 kDa, 127 kDa GenBank Accession Number: BC029658 Gene Symbol: DCBLD2 Gene ID (NCBI): 131566 RRID: AB_2292662 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96PD2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924