Iright
BRAND / VENDOR: Proteintech

Proteintech, 13198-2-AP, Carbonic anhydrase 1/CA1 Polyclonal antibody

CATALOG NUMBER: 13198-2-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Carbonic anhydrase 1/CA1 (13198-2-AP) by Proteintech is a Polyclonal antibody targeting Carbonic anhydrase 1/CA1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 13198-2-AP targets Carbonic anhydrase 1/CA1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse spleen tissue, Jurkat cells, rat spleen tissue Positive IP detected in: K-562 cells Positive IHC detected in: human breast cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CA1(Carbonic anhydrase 1) is also named as CAB and belongs to the alpha-carbonic anhydrase family, which may reside in cytoplasm, in mitochondria, or in secretory granules, or associate with membranes in cell. It forms a large family of genes encoding zinc metalloenzymes of great physiologic importance. Extracellular CA1 mediates hemorrhagic retinal and cerebral vascular permeability through prekallikrein activation(PMID:17259996). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3932 Product name: Recombinant human CA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-261 aa of BC027890 Sequence: MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF Predict reactive species Full Name: carbonic anhydrase I Calculated Molecular Weight: 261 aa, 29 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC027890 Gene Symbol: CA1 Gene ID (NCBI): 759 RRID: AB_2275041 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P00915 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924