Iright
BRAND / VENDOR: Proteintech

Proteintech, 13203-1-AP, DCLRE1B Polyclonal antibody

CATALOG NUMBER: 13203-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DCLRE1B (13203-1-AP) by Proteintech is a Polyclonal antibody targeting DCLRE1B in WB, ELISA applications with reactivity to human, mouse, rat samples 13203-1-AP targets DCLRE1B in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Interstrand cross-links (ICLs) is an extremely cytotoxic form of DNA damage that covalently tethers the two strands of the double helix, which inhibits fundamental nuclear functions, including transcription and DNA replication [PMID:21701511]. DCLRE1B is one of several evolutionarily conserved genes involved in repair of interstrand cross-links [PMID:10848582]. Furthermore, DCLRE1B was identified as a TRF2-interacting protein and, has a role in telomere maintenance in association with the Shelterin complex, preventing non-homologous end-joining-mediated chromosome fusions protecting leading strand telomeres [PMID:20619712]. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3945 Product name: Recombinant human DCLRE1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 183-532 aa of BC029687 Sequence: SLGKESLLEQLALEFQTWVVLSPRRLELVQLLGLADVFTVEEKAGRIHAVDHMEICHSNMLRWNQTHPTIAILPTSRKIHSSHPDIHVIPYSDHSSYSELRAFVAALKPCQVVPIVSRRPCGGFQDSLSPRISVPLIPDSVQQYMSSSSRKPSLLWLLERRLKRPRTQGVVFESPEESADQSQADRDSKKAKKEKLSPWPADLEKQPSHHPLRIKKQLFPDLYSKEWNKAVPFCESQKRVTMLTAPLGFSVHLRSTDEEFISQKTREEIGLGSPLVPMGDDDGGPEATGNQSAWMGHGSPLSHSSKGTPLLATEFRGLALKYLLTPVNFFQAGYSSRRFDQQVEKYHKPC Predict reactive species Full Name: DNA cross-link repair 1B (PSO2 homolog, S. cerevisiae) Calculated Molecular Weight: 532 aa, 60 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC029687 Gene Symbol: DCLRE1B Gene ID (NCBI): 64858 RRID: AB_2292695 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H816 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924