Iright
BRAND / VENDOR: Proteintech

Proteintech, 13229-1-AP, MYL4 Polyclonal antibody

CATALOG NUMBER: 13229-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MYL4 (13229-1-AP) by Proteintech is a Polyclonal antibody targeting MYL4 in WB, ELISA applications with reactivity to human, mouse, rat samples 13229-1-AP targets MYL4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Myosin light‐chain 4 (MYL4) encodes an essential myosin light chain that is expressed in embryonic whole heart and skeletal muscle. It is specifically expressed in human atria after birth. MYL4 is essential for atrial electrical, functional, and structural integrity, and MYL4 dysfunction can produce severe inherited atrial cardiomyopathy. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4031 Product name: Recombinant human MYL4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-197 aa of BC030228 Sequence: MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTADQIEEFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPILQHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSG Predict reactive species Full Name: myosin, light chain 4, alkali; atrial, embryonic Calculated Molecular Weight: 197 aa, 22 kDa Observed Molecular Weight: 22-30 kDa GenBank Accession Number: BC030228 Gene Symbol: MYL4 Gene ID (NCBI): 4635 RRID: AB_2147618 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P12829 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924