Proteintech, 13236-1-AP, NMNAT3 Polyclonal antibody

Size: 20ul / 150ul The NMNAT3 (13236-1-AP) by Proteintech is a Polyclonal antibody targeting NMNAT3 in WB, IF-P, ELISA applications with reactivity to human, mouse, rat samples 13236-1-AP targets NMNAT3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, mouse skeletal muscle tissue Positive IF-P detected in: mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3965 Product name: Recombinant human NMNAT3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-215 aa of BC034374 Sequence: MYQVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHHSKLLRSPPQMEGPDHGKALFSTPAAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCVGRVGHDPKGYIAESPILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLYTKGSTWKGKSTQSTEGKTS Predict reactive species Full Name: nicotinamide nucleotide adenylyltransferase 3 Calculated Molecular Weight: 215 aa, 24 kDa Observed Molecular Weight: 24-28 kDa GenBank Accession Number: BC034374 Gene Symbol: NMNAT3 Gene ID (NCBI): 349565 RRID: AB_2877927 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96T66 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.