Iright
BRAND / VENDOR: Proteintech

Proteintech, 13237-1-AP, DPYS Polyclonal antibody

CATALOG NUMBER: 13237-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DPYS (13237-1-AP) by Proteintech is a Polyclonal antibody targeting DPYS in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 13237-1-AP targets DPYS in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells Positive IHC detected in: human liver tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information DPYS(Dihydropyrimidinase)also known as 5,6-dihydropyrimidine amidohydrolase, or DHP, is the second enzyme in uracil and thymine catabolism. However, in normal human extrahepatic tissues, DPYS, rather than dihydrouracil dehydrogenase, is the rate-limiting enzyme in the pyrimidine base catabolic pathway. DHPase in solid tumors is increased when compared with normal tissues(PMID: 8307005).Defects in DPYS are the cause of dihydropyrimidinase deficiency (DHPD). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3972 Product name: Recombinant human DPYS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 234-519 aa of BC034395 Sequence: ITIASAVNCPLYIVHVMSKSAAKVIADARRDGKVVYGEPIAASLGTDGTHYWNKEWHHAAHHVMGPPLRPDPSTPDFLMNLLANDDLTTTGTDNCTFNTCQKALGKDDFTKIPNGVNGVEDRMSVIWEKGVHSGKMDENRFVAVTSTNAAKIFNLYPRKGRIAVGSDADIVIWDPKGTRTISAKTHHQAVNFNIFEGMVCHGVPLVTISRGKVVYEAGVFSVTAGDGKFIPRKPFAEYIYKRIKQRDRTCTPTPVERAPYKGEVATLKSRVTKEDATAGTRKQAHP Predict reactive species Full Name: dihydropyrimidinase Calculated Molecular Weight: 519 aa, 57 kDa Observed Molecular Weight: 57 kDa GenBank Accession Number: BC034395 Gene Symbol: DPYS Gene ID (NCBI): 1807 RRID: AB_2094329 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14117 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924