Iright
BRAND / VENDOR: Proteintech

Proteintech, 13243-1-AP, CYP4F12 Polyclonal antibody

CATALOG NUMBER: 13243-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CYP4F12 (13243-1-AP) by Proteintech is a Polyclonal antibody targeting CYP4F12 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 13243-1-AP targets CYP4F12 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, human placenta tissue, rat liver tissue Positive IHC detected in: human stomach cancer tissue, human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information CYP4F12(Cytochrome P450 4F12) Catalyzes leukotriene B4 omega-hydroxylation and arachidonic acid omega-hydroxylation but with an activity much lower than that of CYP4F2. It expresses a band of 60KDa in adult and fetal liver, kidney, placenta at term, seminal vesicles, and the prostate gland(PMID:15078342). And it can be phosphorylated in vivo(PMID:18828626). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3957 Product name: Recombinant human CYP4F12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 225-524 aa of BC035350 Sequence: ILELSALVEKRSQHILQHMDFLYYLSHDGRRFHRACRLVHDFTDAVIRERRRTLPTQGIDDFFKDKAKSKTLDFIDVLLLSKDEDGKALSDEDIRAEADTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQELLKDRDPKEIEWDDLAQLPFLTMCVKESLRLHPPAPFISRCCTQDIVLPDGRVIPKGITCLIDIIGVHHNPTVWPDPEVYDPFRFDPENSKGRSPLAFIPFSAGPRNCIGQAFAMAEMKVVLALMLLHFRFLPDHTEPRRKLELIMRAEGGLWLRVEPLNVSLQ Predict reactive species Full Name: cytochrome P450, family 4, subfamily F, polypeptide 12 Calculated Molecular Weight: 524 aa, 60 kDa Observed Molecular Weight: 50-60 kDa GenBank Accession Number: BC035350 Gene Symbol: CYP4F12 Gene ID (NCBI): 66002 RRID: AB_2088412 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HCS2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924