Iright
BRAND / VENDOR: Proteintech

Proteintech, 13254-1-AP, FGFBP2 Polyclonal antibody

CATALOG NUMBER: 13254-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FGFBP2 (13254-1-AP) by Proteintech is a Polyclonal antibody targeting FGFBP2 in WB, IF/ICC, ELISA applications with reactivity to human samples 13254-1-AP targets FGFBP2 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SH-SY5Y cells, BxPC-3 cells Positive IF/ICC detected in: BxPC-3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Fibroblast growth factor-binding protein 2 (FGFBP2), also known as 37 kDa killer-specific secretory protein (KSP37), is a member of the fibroblast growth factor binding protein family. FGFBP2 was identified as a Th1/Tc1 specific secretory protein is expressed preferentially in cytotoxic T lymphocytes (CTL) and natural killer (NK) cells and might be involved in essential processes of CTL-mediated immunity. An increase expression of FGFBP2 may be associated with atopic asthma and mild extrinsic asthma. Recently, an observation revealed that FGFBP2 correlate strongly with histology, stage and outcome in ovarian, and it might be a potential prognostic biomarker. The observed MW of FGFBP2 (37 kDa) varies from the predicated MW of 28 kDa, which may be due to the specific space conformation caused by internal disulfide bonds. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4036 Product name: Recombinant human FGFBP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 22-223 aa of BC025720 Sequence: PRQKQGSTGEEFHFQTGGRDSCTMRPSSLGQGAGEVWLRVDCRNTDQTYWCEYRGQPSMCQAFAADPKPYWNQALQELRRLHHACQGAPVLRPSVCREAGPQAHMQQVTSSLKGSPEPNQQPEAGTPSLRPKATVKLTEATQLGKDSMEELGKAKPTTRPTAKPTQPGPRPGGNEEAKKKAWEHCWKPFQALCAFLISFFRG Predict reactive species Full Name: fibroblast growth factor binding protein 2 Calculated Molecular Weight: 223 aa, 28 kDa Observed Molecular Weight: 37 kDa GenBank Accession Number: BC025720 Gene Symbol: FGFBP2 Gene ID (NCBI): 83888 RRID: AB_2103095 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BYJ0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924