Iright
BRAND / VENDOR: Proteintech

Proteintech, 13256-1-AP, MLXIPL Polyclonal antibody

CATALOG NUMBER: 13256-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MLXIPL (13256-1-AP) by Proteintech is a Polyclonal antibody targeting MLXIPL in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 13256-1-AP targets MLXIPL in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, human liver tissue, HepG2 cells, HeLa cells, rat liver tissue Positive IP detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Carbohydrate response element-binding protein (ChREBP), also known as MLXIPL, is a glucose-responsive transcription factor that has a fundamental role in the glucose-mediated induction of genes involved in hepatic glycolysis and lipogenesis. Circulating blood glucose levels affect ChREBP activity in hepatocytes largely by post-translational mechanisms that include phosphorylation-dependent subcellular localization [PMID:21665952]. It enhances expression of the liver pyruvate kinase (LPK) gene and all lipogenic enzyme genes resulting in the conversion of excess dietary carbohydrate into triglycerides that can be stored as fat [PMID:15118080]. Molecular Weight of ChREBP splice variants: 62/78/91/93 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3481 Product name: Recombinant human MLXIPL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC012925 Sequence: MAGALAGLAAGLQVPRVAPSPDSDSDTDSEDPSLRRSAGGLLRSQVIHSGHFMVSSPHSDSLPRRRDQEGSVGPSDFGPRSIDPTLTRLFECLSLAYSGKLVSPKWKNFKGLKLLCRDKIRLNNAIWRAWYIQYVKRRKSPVCGFVTPLQGPEADAHRKPEAVVLEGNYWKRRIELPPEDAYVGNADMIQPDLTPLQPSLDDFMDISDFFTNSRLPQPPMPSNFPEPPSFSPVVDSLFSSGTLGPEVPPASSAMTHLSGHSRLQARNSCPGPLDSSAFLSSDFLLPEDPKPRLPPPPVPPPLLHYPPPAKVPGLEPCPPPPFPPMAPPTALLQEEPLFSPRFPFPTVPPA Predict reactive species Full Name: MLX interacting protein-like Calculated Molecular Weight: 852 aa, 93 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: BC012925 Gene Symbol: MLXIPL Gene ID (NCBI): 51085 RRID: AB_2266665 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NP71 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924