Proteintech, 13270-1-AP, MPPED2 Polyclonal antibody

Size: 20ul / 150ul The MPPED2 (13270-1-AP) by Proteintech is a Polyclonal antibody targeting MPPED2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 13270-1-AP targets MPPED2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human brain tissue Positive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells, Hela cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3963 Product name: Recombinant human MPPED2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-294 aa of BC031582 Sequence: MAHGIPSQGKVTITVDEYSSNPTQAFTHYNINQSRFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHTGDFTELGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS Predict reactive species Full Name: metallophosphoesterase domain containing 2 Calculated Molecular Weight: 294 aa, 33 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC031582 Gene Symbol: MPPED2 Gene ID (NCBI): 744 RRID: AB_2144517 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15777 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.