Proteintech, 13279-1-AP, TRAT1 Polyclonal antibody

Size: 20ul / 150ul The TRAT1 (13279-1-AP) by Proteintech is a Polyclonal antibody targeting TRAT1 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 13279-1-AP targets TRAT1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse thymus tissue, Jurkat cells Positive IP detected in: Jurkat cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4023 Product name: Recombinant human TRAT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-186 aa of BC025713 Sequence: ISHYVEKQRQDKMYSYSSDHTRVDEYYIEDTPIYGNLDDMISEPMDENCYEQMKARPEKSVNKMQEATPSAQATNETQMCYASLDHSVKGKRRKPRKQNTHFSDKDGDEQLHAIDASVSKTTLVDSFSPESQAVEENIHDDPIRLFGLIRAKREPIN Predict reactive species Full Name: T cell receptor associated transmembrane adaptor 1 Calculated Molecular Weight: 186 aa, 21 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC025713 Gene Symbol: TRAT1 Gene ID (NCBI): 50852 RRID: AB_10643524 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6PIZ9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.