Iright
BRAND / VENDOR: Proteintech

Proteintech, 13280-1-AP, CEND1 Polyclonal antibody

CATALOG NUMBER: 13280-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CEND1 (13280-1-AP) by Proteintech is a Polyclonal antibody targeting CEND1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 13280-1-AP targets CEND1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, SH-SY5Y cells, human brain tissue, rat brain tissue Positive IHC detected in: mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Neuro-2a cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Cell cycle exit and neuronal differentiation 1 (CEND1) also known as BM88, is a neuronal protein associated in vivo with terminal neuron-generating divisions, marking the exit of proliferative cells from the cell cycle (PMID: 17971443). CEND1 expression is critical for the NEUROG2-driven reprogramming of astrocytes, suggesting the existence of a reciprocal feedback loop leading to neurogenesis (PMID: 26321141). CEND1 is an integral membrane protein composed of two 23-kDa polypeptide chains linked together by disulfide bridges. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: rat, goat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4024 Product name: Recombinant human CEND1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-123 aa of BC034732 Sequence: MESRGKSASSPKPDTKVPQVTTEAKVPPAADGKAPLTKPSKKEAPAEKQQPPAAPTTAPAKKTSAKADPALLNNHSNLKPAPTVPSSPDATPEPKGPGDGAEEDEAASGGPGGRGPWSCENFN Predict reactive species Full Name: cell cycle exit and neuronal differentiation 1 Calculated Molecular Weight: 149 aa, 15 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC034732 Gene Symbol: CEND1 Gene ID (NCBI): 51286 RRID: AB_2291632 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N111 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924