Proteintech, 13307-1-AP, Galanin Polyclonal antibody

Size: 20ul / 150ul The Galanin (13307-1-AP) by Proteintech is a Polyclonal antibody targeting Galanin in IHC, ELISA applications with reactivity to human samples 13307-1-AP targets Galanin in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human pituitary adenoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information Galanin is a neuroendocrine peptide that is widely expressed in the central and peripheral nervous systems and also the gastrointestinal tract, pancreas, adrenal gland and urogenital tract. The encoded protein is a precursor that is proteolytically processed to generate two mature peptides: galanin and galanin message-associated peptide (GMAP). Galanin has diverse physiological functions including nociception, feeding and energy homeostasis, osmotic regulation and water balance. GMAP has been demonstrated to possess antifungal activity and hypothesized to be part of the innate immune system Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4136 Product name: Recombinant human GAL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-123 aa of BC030241 Sequence: LWSPAKEKRGWTLNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS Predict reactive species Full Name: galanin prepropeptide Calculated Molecular Weight: 123 aa, 13 kDa GenBank Accession Number: BC030241 Gene Symbol: GAL Gene ID (NCBI): 51083 RRID: AB_3085412 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P22466 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.