Proteintech, 13332-1-AP, CD94 Polyclonal antibody

Size: 20ul / 150ul The CD94 (13332-1-AP) by Proteintech is a Polyclonal antibody targeting CD94 in WB, ELISA applications with reactivity to human samples 13332-1-AP targets CD94 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, K-562 cells, NK-92 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information CD94, also known as KLRD1, is a membrane protein that is preferentially expressed on NK cells. CD94 can form disulfide-bonded heterodimers with NKG2 family members. The CD94/NKG2A heterodimer constitutes an inhibitory receptor that recognizes HLA-E. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4142 Product name: Recombinant human KLRD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 36-179 aa of BC028009 Sequence: TKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGNALDESCEDKNRYICKQQLI Predict reactive species Full Name: killer cell lectin-like receptor subfamily D, member 1 Calculated Molecular Weight: 179 aa, 20 kDa Observed Molecular Weight: 43 kDa GenBank Accession Number: BC028009 Gene Symbol: CD94 Gene ID (NCBI): 3824 RRID: AB_10637852 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13241 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.