Iright
BRAND / VENDOR: Proteintech

Proteintech, 13337-1-AP, ADAMTSL1 Polyclonal antibody

CATALOG NUMBER: 13337-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ADAMTSL1 (13337-1-AP) by Proteintech is a Polyclonal antibody targeting ADAMTSL1 in WB, ELISA applications with reactivity to human, mouse, rat samples 13337-1-AP targets ADAMTSL1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information ADAMTS-like genes (ADAMTSLs) produce proteins similar to those encoded by ADAMTS genes, only without catalytic domains, and may be responsible for regulating activities of ADAMTS. ADAMTSL1 was first identified in 1997 and was called punctin. ADAMTSL1 is distinct from other genes in the ADAMTS family, and binds to the extracellular matrix in a spatially-specific manner. (PMID: 32095376) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4154 Product name: Recombinant human ADAMTSL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-355 aa of BC030262 Sequence: MECCRRATPGTLLLFLAFLLLSSRTARSEEDRDGLWDAWGPWSECSRTCGGGASYSLRRCLSSKSCEGRNIRYRTCSNVDCPPEAGDFRAQQCSAHNDVKHHGQFYEWLPVSNDPDNPCSLKCQAKGTTLVVELAPKVLDGTRCYTESLDMCISGLCQIVGCDHQLGSTVKEDNCGVCNGDGSTCRLVRGQYKSQLSATKSDDTVVAIPYGSRHIRLVLKGPDHLYLETKTLQGTKGENSLSSTGTFLVDNSSVDFQKFPDKEILRMAGPLTADFIVKIRNSGSADSTVQFIFYQPIIHRWRETDFFPCSATCGGGYQLTSAECYDLRSNRVVADQYCHYYPENIKPKPKLQECN Predict reactive species Full Name: ADAMTS-like 1 Calculated Molecular Weight: 525 aa, 58 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC030262 Gene Symbol: ADAMTSL1 Gene ID (NCBI): 92949 RRID: AB_3669160 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N6G6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924