Iright
BRAND / VENDOR: Proteintech

Proteintech, 13338-1-AP, ICOS/CD278 Polyclonal antibody

CATALOG NUMBER: 13338-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ICOS/CD278 (13338-1-AP) by Proteintech is a Polyclonal antibody targeting ICOS/CD278 in WB, IHC, IF-P, ELISA applications with reactivity to human samples 13338-1-AP targets ICOS/CD278 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, HL-60 cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human tonsillitis tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Inducible T cell co-stimulator (ICOS) is related to the CD28 superfamily and is highly expressed on activated T cells as well as regulatory T cells and is crucial for the survival and function of T cells, Th2 cell differentiation, and lung inflammatory responses. Binding ICOS to ICOS-ligand (ICOS-L) activates a cascade of intracellular signaling molecules that prevent apoptosis and lead to the production of cytokines such as IL-4 and IL-13. Catalog#13338-1-AP recognizes two bands of 25-30 kDa and 45-50 kDa, and the additional 45-50 kDa band may be due to  surface disulfide-linked homodimeric glycoprotein. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4155 Product name: Recombinant human ICOS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-142 aa of BC028210 Sequence: MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKFW Predict reactive species Full Name: inducible T-cell co-stimulator Calculated Molecular Weight: 199 aa, 23 kDa Observed Molecular Weight: 28 kDa, 45-50 kDa GenBank Accession Number: BC028210 Gene Symbol: ICOS Gene ID (NCBI): 29851 RRID: AB_2122590 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y6W8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924