Proteintech, 13341-1-AP, TAF1C Polyclonal antibody

Size: 20ul / 150ul The TAF1C (13341-1-AP) by Proteintech is a Polyclonal antibody targeting TAF1C in WB, IHC, ELISA applications with reactivity to human samples 13341-1-AP targets TAF1C in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HT-1080 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4164 Product name: Recombinant human TAF1C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 472-775 aa of BC028131 Sequence: IGLAAVVPPMPSAPTPGLVLFQLSAAGDVFYQQLRPQVDSSLRRDAGPPGDTQPDCHAPTASWTSQDTAGCSQWLKALLKVPLAPPVWTAPTFTHRQMLGSTELRREEEEGQRLGVLRKAMARGQLLLQRDLGSLPAAEPPPAPESGLEDKLSERLGEAWAGRGAAWWERQQGRTSEPGRQTRRPKRRTQLSSSFSLSGHVDPSEDTSSPHSPEWPPADALPLPPTTPPSQELTPDACAQGVPSEQRQMLRDYMAKLPPQRDTPGCATTPPHSQASSVRATRSQQHTPVLSSSQPLRKKPRMGF Predict reactive species Full Name: TATA box binding protein (TBP)-associated factor, RNA polymerase I, C, 110kDa Calculated Molecular Weight: 869 aa, 95 kDa Observed Molecular Weight: 95 kDa GenBank Accession Number: BC028131 Gene Symbol: TAF1C Gene ID (NCBI): 9013 RRID: AB_10646433 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15572 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.