Product Description
Size: 20ul / 150ul
The TBRG1 (13346-1-AP) by Proteintech is a Polyclonal antibody targeting TBRG1 in WB, ELISA applications with reactivity to human samples
13346-1-AP targets TBRG1 in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: BxPC-3 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag4179 Product name: Recombinant human TBRG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-123 aa of BC032312 Sequence: MSLLDGLASSPRAPLQSSKARMKKLPKKSQNEKYRLKYLRLRKAAKATVFVSLTHVQPVPSWRLPHKIFPQAVPPSQCDSINTVLAFPYTLLLVSLVSLDKLRNFSVSSSVNELVTVLQNNEY Predict reactive species
Full Name: transforming growth factor beta regulator 1
Calculated Molecular Weight: 45 kDa
Observed Molecular Weight: 45 kDa
GenBank Accession Number: BC032312
Gene Symbol: TBRG1
Gene ID (NCBI): 84897
RRID: AB_10644330
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q3YBR2
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924