Iright
BRAND / VENDOR: Proteintech

Proteintech, 13356-1-AP, IL-10RA Polyclonal antibody

CATALOG NUMBER: 13356-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The IL-10RA (13356-1-AP) by Proteintech is a Polyclonal antibody targeting IL-10RA in WB, ELISA applications with reactivity to human, mouse, rat samples 13356-1-AP targets IL-10RA in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, human heart tissue, human placenta tissue, human liver tissue, K-562 cells, mouse brain tissue, rat brain tissue, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Interleukin-10 (IL-10) is an anti-inflammatory cytokine that plays a critical role in maintaining immune system balance. IL-10 signals through a receptor complex consisting of two molecules of the IL-10R alpha-chain (IL-10RA) and two molecules of the accessory IL-10R beta-chain (IL-10RB) (PMID: 22236434). IL-10RA and IL-10RB are members of the type II cytokine receptor family. IL-10RA, also known as IL-10R1 or CD210, is expressed on most hematopoietic cells at a basal level but is upregulated by various cells upon activation (PMID: 24507158). IL-10RA serves as the ligand-binding subunit of the receptor complex. Upon binding of IL-10 to the IL-10R complex, the kinases JAK1 and TYK2 are activated and catalyze the phosphorylation of IL-10RA at specific intracellular tyrosine residues, leading to the recruitment and subsequent phosphorylation of STAT3 (PMID: 11244051; 10433356). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4156 Product name: Recombinant human IL-10RA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 253-578 aa of BC028082 Sequence: CLALQLYVRRRKKLPSVLLFKKPSPFIFISQRPSPETQDTIHPLDEEAFLKVSPELKNLDLHGSTDSGFGSTKPSLQTEEPQFLLPDPHPQADRTLGNGEPPVLGDSCSSGSSNSTDSGICLQEPSLSPSTGPTWEQQVGSNSRGQDDSGIDLVQNSEGRAGDTQGGSALGHHSPPEPEVPGEEDPAAVAFQGYLRQTRCAEEKATKTGCLEEESPLTDGLGPKFGRCLVDEAGLHPPALAKGYLKQDPLEMTLASSGAPTGQWNQPTEEWSLLALSSCSDLGISDWSFAHDLAPLGCVAAPGGLLGSFNSDLVTLPLISSLQSSE Predict reactive species Full Name: interleukin 10 receptor, alpha Calculated Molecular Weight: 578 aa, 63 kDa Observed Molecular Weight: 70-72 kDa, 90-95 kDa GenBank Accession Number: BC028082 Gene Symbol: IL-10RA Gene ID (NCBI): 3587 RRID: AB_10643390 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13651 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924