Product Description
Size: 20ul / 150ul
The LYNX1 (13373-1-AP) by Proteintech is a Polyclonal antibody targeting LYNX1 in IHC, ELISA applications with reactivity to human, mouse, rat samples
13373-1-AP targets LYNX1 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive IHC detected in: human oesophagus cancer tissue, mouse brain tissue, human oesophagus tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Immunohistochemistry (IHC): IHC : 1:50-1:500
Background Information
LYNX1, also named as SLURP2, is a neuronal membrane molecule related to snake a-neurotoxins able to modulate nicotinic acetylcholine receptors (nAChRs). It acts in different tissues through interaction to nAChRs to balance neuronal activity.
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag4195 Product name: Recombinant human LYNX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-131 aa of BC032306 Sequence: LDCHVCAYNGDNCFNPMRCPAMVAYCMTTRTSAAEAIWCHQCTGFGGCSHGSRCLRDSTHCVTTATRVLSNTEDLPLVTKMCHIGCPDIPSLGLGPYVSIACCQTSLCNHD Predict reactive species
Full Name: Ly6/neurotoxin 1
Calculated Molecular Weight: 131 aa, 14 kDa
GenBank Accession Number: BC032306
Gene Symbol: LYNX1
Gene ID (NCBI): 66004
RRID: AB_2877944
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9BZG9
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924