Iright
BRAND / VENDOR: Proteintech

Proteintech, 13394-1-AP, CLEC1A Polyclonal antibody

CATALOG NUMBER: 13394-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CLEC1A (13394-1-AP) by Proteintech is a Polyclonal antibody targeting CLEC1A in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 13394-1-AP targets CLEC1A in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse lung tissue, mouse thymus tissue, rat lung tissue Positive IHC detected in: mouse lung tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CLEC1A (C-type lectin domain family 1 member A) is a single-pass type II membrane protein that contains one C-type lectin domain. Members of the C-type lectin domain family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. CLEC1A is expressed preferentially in dendritic cells and plays a role in regulating dendritic cell function (PMID: 10671229). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4058 Product name: Recombinant human CLEC1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 74-280 aa of BC039072 Sequence: QYYQLSNTGQDTISQMEERLGNTSQELQSLQVQNIKLAGSLQHVAEKLCRELYNKAGAHRCSPCTEQWKWHGDNCYQFYKDSKSWEDCKYFCLSENSTMLKINKQEDLEFAASQSYSEFFYSYWTGLLRPDSGKAWLWMDGTPFTSELFHIIIDVTSPRSRDCVAILNGMIFSKDCKELKRCVCERRAGMVKPESLHVPPETLGEGD Predict reactive species Full Name: C-type lectin domain family 1, member A Calculated Molecular Weight: 280 aa, 32 kDa Observed Molecular Weight: 50 kDa, 32 kDa GenBank Accession Number: BC039072 Gene Symbol: CLEC1A Gene ID (NCBI): 51267 RRID: AB_2083443 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NC01 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924