Proteintech, 13397-1-AP, CCL19/MIP-3 beta Polyclonal antibody

Size: 20ul / 150ul The CCL19/MIP-3 beta (13397-1-AP) by Proteintech is a Polyclonal antibody targeting CCL19/MIP-3 beta in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 13397-1-AP targets CCL19/MIP-3 beta in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: THP-1 cells Positive IF/ICC detected in: A549 cells Positive FC (Intra) detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information CCL19, also known as MIP-3β, is one of several CC cytokine genes clustered on the p-arm of chromosome 9. CCL19 may play a role in normal lymphocyte recirculation and homing. It also plays an important role in trafficking of T cells in thymus, and in T cell and B cell migration to secondary lymphoid organs. It specifically binds to chemokine receptor CCR7. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4200 Product name: Recombinant human MIP­3β protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-98 aa of BC027968 Sequence: MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS Predict reactive species Full Name: chemokine (C-C motif) ligand 19 Calculated Molecular Weight: 98 aa, 12 kDa Observed Molecular Weight: 11 kDa GenBank Accession Number: BC027968 Gene Symbol: CCL19/MIP-3 beta Gene ID (NCBI): 6363 RRID: AB_2071529 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99731 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.