Product Description
Size: 20ul / 150ul
The CCL19/MIP-3 beta (13397-1-AP) by Proteintech is a Polyclonal antibody targeting CCL19/MIP-3 beta in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples
13397-1-AP targets CCL19/MIP-3 beta in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: THP-1 cells
Positive IF/ICC detected in: A549 cells
Positive FC (Intra) detected in: A549 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
Background Information
CCL19, also known as MIP-3β, is one of several CC cytokine genes clustered on the p-arm of chromosome 9. CCL19 may play a role in normal lymphocyte recirculation and homing. It also plays an important role in trafficking of T cells in thymus, and in T cell and B cell migration to secondary lymphoid organs. It specifically binds to chemokine receptor CCR7.
Specification
Tested Reactivity: human
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag4200 Product name: Recombinant human MIP3β protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-98 aa of BC027968 Sequence: MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS Predict reactive species
Full Name: chemokine (C-C motif) ligand 19
Calculated Molecular Weight: 98 aa, 12 kDa
Observed Molecular Weight: 11 kDa
GenBank Accession Number: BC027968
Gene Symbol: CCL19/MIP-3 beta
Gene ID (NCBI): 6363
RRID: AB_2071529
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q99731
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924