Iright
BRAND / VENDOR: Proteintech

Proteintech, 13406-1-AP, ATG10 Polyclonal antibody

CATALOG NUMBER: 13406-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ATG10 (13406-1-AP) by Proteintech is a Polyclonal antibody targeting ATG10 in WB, ELISA applications with reactivity to human samples 13406-1-AP targets ATG10 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information ATG10, also named as APG10L, is an E2-like enzyme involved in autophagy. It catalyzes the conjugation reaction between Atg12 and Atg5. ATG10 plays a role in adenovirus-mediated cell lysis. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4052 Product name: Recombinant human ATG10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-220 aa of BC029268 Sequence: MEEDEFIGEKTFQRYCAEFIKHSQQIGDSWEWRPSKDCSDGYMCKIHFQIKNGSVMSHLGASTHGQTCLPMEEAFELPLDDCEVIETAAASEVIKYEYHVLYSCSYQVPVLYFRASFLDGRPLTLKDIWEGVHECYKMRLLQGPWDTITQQEHPILGQPFFVLHPCKTNEFMTPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYAKATSQDERNVP Predict reactive species Full Name: ATG10 autophagy related 10 homolog (S. cerevisiae) Calculated Molecular Weight: 220 aa, 25 kDa Observed Molecular Weight: 25-30 kDa GenBank Accession Number: BC029268 Gene Symbol: ATG10 Gene ID (NCBI): 83734 RRID: AB_3669161 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H0Y0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924