Proteintech, 13433-1-AP, ACYP1 Polyclonal antibody

Size: 20ul / 150ul The ACYP1 (13433-1-AP) by Proteintech is a Polyclonal antibody targeting ACYP1 in WB, ELISA applications with reactivity to human, mouse, rat samples 13433-1-AP targets ACYP1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue, human brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4237 Product name: Recombinant human ACYP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-99 aa of BC035568 Sequence: MAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVK Predict reactive species Full Name: acylphosphatase 1, erythrocyte (common) type Calculated Molecular Weight: 99 aa, 11 kDa Observed Molecular Weight: 11 kDa GenBank Accession Number: BC035568 Gene Symbol: ACYP1 Gene ID (NCBI): 97 RRID: AB_2242288 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P07311 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.