Proteintech, 13434-1-AP, ALS2CR8 Polyclonal antibody

Size: 20ul / 150ul The ALS2CR8 (13434-1-AP) by Proteintech is a Polyclonal antibody targeting ALS2CR8 in IHC, ELISA applications with reactivity to human samples 13434-1-AP targets ALS2CR8 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4238 Product name: Recombinant human ALS2CR8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-311 aa of BC033777 Sequence: MEQSNDSLRVNHNDGEESKTSAQVFEHLICMDSRDSSFGQNDSPTVLPITTREANNSLISQNIPGPLTQTQTLSAEQFHLVDQNGQAIQYELQSLGESNAQMMIVASPTENGQVLRVIPPTQTGMAQVIIPQGQLVDVNSPRDVPEEKPSNRNLPTVRVDTLADNTSNYILHPQTSFPLPKKSVTGMLEEPLLGPLQPLSSNTPIWACRLRSCEKIGDSYRGYCVSETELESVLTFHKQQTQSVWGTRQSPSPAKPATRLMWKSQYVPYDGIPFVNAGSRAVVMECQYGPRRKGFQLKKVSEQESRSCQLY Predict reactive species Full Name: amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 8 Calculated Molecular Weight: 725 aa, 81 kDa GenBank Accession Number: BC033777 Gene Symbol: ALS2CR8 Gene ID (NCBI): 79800 RRID: AB_2877947 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N187 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.