Iright
BRAND / VENDOR: Proteintech

Proteintech, 13486-1-AP, PIAS3 Polyclonal antibody

CATALOG NUMBER: 13486-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PIAS3 (13486-1-AP) by Proteintech is a Polyclonal antibody targeting PIAS3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 13486-1-AP targets PIAS3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, HeLa cells Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:100-1:400 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information PIAS3(E3 SUMO-protein ligase PIAS3) is a protein of 583 amino acid, has a molecular mass of 68 kDa and belongs to a family of proteins that includes several other members(PMID:11060035). PIAS3 is an inhibitor of activated STAT3 and binds microphthalmia-associated transcription factor, which is a key DNA-binding protein, in rat basophilic leukemia cells and mouse melanocytes(PMID:11709556). The PIAS3 antibody detects PIAS3 (68 kDa) as well as its sumoylated form (85 kDa) in some normal mouse tissues, breast and brain tumor cell lines(PMID:20371673). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4304 Product name: Recombinant human PIAS3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 277-628 aa of BC030556 Sequence: VRQLTAGTLLQKLRAKGIRNPDHSRALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALYLQMNEKKPTWTCPVCDKKAPYESLIIDGLFMEILSSCSDCDEIQFMEDGSWCPMKPKKEASEVCPPPGYGLDGLQYSPVQGGDPSENKKKVEVIDLTIESSSDEEDLPPTKKHCSVTSAAIPALPGSKGVLTSGHQPSSVLRSPAMGTLGGDFLSSLPLHEYPPAFPLGADIQGLDLFSFLQTESQHYGPSVITSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHCSATPAPPPGRVSSIVAPGGALREGHGGPLPSGPSLTGCRSDIISLD Predict reactive species Full Name: protein inhibitor of activated STAT, 3 Calculated Molecular Weight: 628 aa, 68 kDa Observed Molecular Weight: 67 kDa GenBank Accession Number: BC030556 Gene Symbol: PIAS3 Gene ID (NCBI): 10401 RRID: AB_2164224 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y6X2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924